Protein Info for H281DRAFT_01243 in Paraburkholderia bryophila 376MFSha3.1

Annotation: lipoprotein, YaeC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF03180: Lipoprotein_9" amino acids 35 to 266 (232 residues), 169 bits, see alignment E=4.9e-54

Best Hits

Swiss-Prot: 33% identical to METQ_SALTY: D-methionine-binding lipoprotein MetQ (metQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 70% identity to bpy:Bphyt_4472)

Predicted SEED Role

"Methionine ABC transporter substrate-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation or Staphylococcal pathogenicity islands SaPI

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>H281DRAFT_01243 lipoprotein, YaeC family (Paraburkholderia bryophila 376MFSha3.1)
MNPRRVVNAAISAVLIGAAAMCGSAVFADAAQPAVKVGVRRGTHAEIMNEVRRVATARGL
DIDVVTFDSGAQIDAALAAHRIDAASFEDGPGFEASRRKHGFPLYEVATTVTLPMALYSR
QLTSLAQIRRGASVVIPDDREGMARALVLLQNYTLLTFDDSAGLHATLRDVTGNRLNLTL
RALPRNRLVAALNAATIVVMDSESAQRAGLYPARDSIGIEDARSPYAGVLAVREAERGEP
WVAQLVSAYHSNDVAHFILTRYQDSVRRPW