Protein Info for H281DRAFT_00945 in Paraburkholderia bryophila 376MFSha3.1

Annotation: UDP-glucose dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03721: UDPG_MGDP_dh_N" amino acids 1 to 186 (186 residues), 216.1 bits, see alignment E=4.8e-68 TIGR03026: nucleotide sugar dehydrogenase" amino acids 1 to 432 (432 residues), 450 bits, see alignment E=3.7e-139 PF00984: UDPG_MGDP_dh" amino acids 208 to 300 (93 residues), 127.1 bits, see alignment E=3.5e-41 PF03720: UDPG_MGDP_dh_C" amino acids 324 to 436 (113 residues), 106.9 bits, see alignment E=9.6e-35

Best Hits

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 95% identity to bgf:BC1003_1670)

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MB09 at UniProt or InterPro

Protein Sequence (482 amino acids)

>H281DRAFT_00945 UDP-glucose dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MNLTIIGSGYVGLVTGACLADIGHDVFCLDVDQRKIDVLNNGGVPIHEPGLQEIIARNRK
AGRLTFSTDVEAAVAHGDIQFIAVGTPSDEDGSADLQYVLAAARNIGRHMTGFKVIVDKS
TVPVGTASRVREAIAQELETRGLSHMFSVVSNPEFLKEGAAVEDFTRPDRIVLGCDEDVP
GEKARELMKRLYAPFNRNRERTLYMDVRSAEFTKYAANAMLATRISYMNELANLADRVGA
DIEAVRRGIGSDPRIGYDFLYAGCGYGGSCFPKDVQALIRTAADHNANLRILEAVEAVND
TQKKVLAQKIVARLGEDLSDRTFAVWGLAFKPNTDDMREAPSRPLIAELLRRGARVKAYD
PVAIDESKRVFALDLKDVPQQHARLHFANEEMEAADGADALVILTEWKVFKSPDFDALKT
ILKTPLIFDGRNLYEPDTLLELGIEYHAIGRQHALRNAPARVGANGLPLTPADALAAAEA
GH