Protein Info for H281DRAFT_00528 in Paraburkholderia bryophila 376MFSha3.1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF00156: Pribosyltran" amino acids 24 to 169 (146 residues), 95.1 bits, see alignment E=1.4e-31

Best Hits

KEGG orthology group: K07101, (no description) (inferred from 98% identity to bxe:Bxe_A1607)

Predicted SEED Role

"Xanthine-guanine phosphoribosyltransferase (EC 2.4.2.22)" in subsystem Purine conversions (EC 2.4.2.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MA95 at UniProt or InterPro

Protein Sequence (196 amino acids)

>H281DRAFT_00528 hypothetical protein (Paraburkholderia bryophila 376MFSha3.1)
MVQGLPMIAMKDPRNDDKNLWVGWDEYHRLIELLAMAVHESGWKFDKILCLARGGLRVGD
QLSRIYDLPLAILATSSYREAAGTEQGELDIAQYITMTRGELHGNVLLVDDLVDSGVTLA
RVQQHLKERYPAITAVRSAVLWYKGCSKVKPDYHVQYLPTNPWIHQPFEEWDTVRPHNLG
AWIKRGVAQAQESSGN