Protein Info for H281DRAFT_00294 in Paraburkholderia bryophila 376MFSha3.1

Annotation: electron transport complex protein RnfB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 37 to 194 (158 residues), 213.8 bits, see alignment E=8.1e-68 PF04060: FeS" amino acids 51 to 83 (33 residues), 46.3 bits, see alignment 8.1e-16 PF14697: Fer4_21" amino acids 116 to 170 (55 residues), 66.2 bits, see alignment 7e-22 PF13237: Fer4_10" amino acids 117 to 164 (48 residues), 27.7 bits, see alignment 6.8e-10 PF00037: Fer4" amino acids 117 to 138 (22 residues), 29.6 bits, see alignment (E = 1.3e-10) amino acids 147 to 169 (23 residues), 21.4 bits, see alignment (E = 5.2e-08)

Best Hits

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 77% identity to bgf:BC1003_1019)

Predicted SEED Role

"Iron-sulfur cluster-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>H281DRAFT_00294 electron transport complex protein RnfB (Paraburkholderia bryophila 376MFSha3.1)
MAHGLPMAIGEIGDNVLFSSSCAAAPPSPAWPHIVTVTQIKTLADRIEDLLPQTQCTKCG
YPACRPYAEAVACGEANYNQCPPGGQEGVARLAALLGKPVIPLNSANGVERPRPLAVIDE
QVCIGCTLCMQACPVDAIVGAPKHMHTVVAELCTGCDLCVPPCPVDCISMPPVTGDATGW
DAWSQPLADAARERHNRREARLAREREAAEARVAARRSSAAASGATTAAATAPAGNVSTP
SVSPASTAENADAEAKKRAIIQAALERARKKKEELAAKGHVPLNTEQVSADVQAQIDAAE
ARRRRLGLTGTGTDQRTDKRIDKPADDTAGNPPPSTPAGTRNPR