Protein Info for H281DRAFT_00270 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF14588: YjgF_endoribonc" amino acids 10 to 152 (143 residues), 63.4 bits, see alignment E=2.2e-21 PF01042: Ribonuc_L-PSP" amino acids 22 to 153 (132 residues), 55.2 bits, see alignment E=7.1e-19

Best Hits

Swiss-Prot: 48% identical to TCP17_TRYCR: Protein TCP17 (TCP17) from Trypanosoma cruzi

KEGG orthology group: None (inferred from 93% identity to bge:BC1002_0840)

Predicted SEED Role

"RidA/YER057c/UK114 superfamily, group 2, YoaB-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9E9 at UniProt or InterPro

Protein Sequence (154 amino acids)

>H281DRAFT_00270 Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family (Paraburkholderia bryophila 376MFSha3.1)
MAQTNVYDKLKELGIELPNAGAPAAAYVMSAQSGNTVYLSGHIAKKDGKVWAGKLGAELS
TEDGKAAARSIAIDLLATLHAHVGDLNRVTRIVKLMSLVNSTHEFTEQHLVTNGASELVA
DVFGERGKHARSAFGVAQIPLGACVEIEMIAEVE