Protein Info for H281DRAFT_00263 in Paraburkholderia bryophila 376MFSha3.1

Annotation: ATP-binding cassette, subfamily F, uup

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 PF00005: ABC_tran" amino acids 19 to 189 (171 residues), 92.7 bits, see alignment E=1.3e-29 amino acids 342 to 473 (132 residues), 81.9 bits, see alignment E=3e-26 PF12848: ABC_tran_Xtn" amino acids 228 to 301 (74 residues), 39.8 bits, see alignment E=1.6e-13 PF16326: ABC_tran_CTD" amino acids 577 to 645 (69 residues), 64.3 bits, see alignment E=3.9e-21

Best Hits

Swiss-Prot: 50% identical to UUP1_HAEIN: ABC transporter ATP-binding protein uup-1 (uup-A) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 94% identity to bug:BC1001_0916)

Predicted SEED Role

"COG0488: ATPase components of ABC transporters with duplicated ATPase domains" in subsystem Folate Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MB89 at UniProt or InterPro

Protein Sequence (649 amino acids)

>H281DRAFT_00263 ATP-binding cassette, subfamily F, uup (Paraburkholderia bryophila 376MFSha3.1)
MSLYTITGAQLAFGHVALLDHADFSLESGERVGLIGRNGAGKSSLLKIVAELAKPDDGLV
TRQQNLTTVYVPQEPEFDTDDTVFDAVAAGLTHARALLDEYDAVANQLADEPEGAQHDAL
MARMNTLQSSLDAADAWNWSTRVATTLQQIGLNGEARVGSLSGGMQKRVALARALVVQPD
VLLLDEPTNHLDFDGIRWLEDLLVSQRAALLFITHDRAFLDRVATRIVELDRGRLLSYPG
NFSAYQTRKAQQLEIERVENEKADKLLAQEEVWIRKGVEARRTRSVGRIARLVEMRNQRA
ERRNVQGNVKLDVGQGEKSGKIVAELTDVTKRYGSRTVIDSFTATVMRGDKIGFVGPNGA
GKTTLLKIILGELQPDEGTVRVGTNLQVAYFDQMRAQLDLDKSLADTISPGSEWVEVNGQ
KKHVMSYLGDFLFAPERARSPVKSLSGGERNRLLLARLFARPANVLVLDEPTNDLDIPTL
ELLEELLTDYDGTVLLVSHDRAFLDNVATSVIASEGGGKWREYVGGFTDWQIQSQRSQQM
AQEAQKEANKDAAKDSAKDSAASKDSPAGRNTQRAAKLSFKEQRELEALPEKIAALEAEQ
KAIGAQLEDGSIFAKDAQEGKRLSERYAAIDEELLLALERWDELEKRRK