Protein Info for Ga0059261_3899 in Sphingomonas koreensis DSMZ 15582

Updated annotation (from data): Alanine dehydrogenase (EC 1.4.1.1)
Rationale: Specifically important for utilizing L-Alanine. Automated validation from mutant phenotype: the predicted function (ALANINE-DEHYDROGENASE-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: alanine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 224 to 250 (27 residues), see Phobius details TIGR00518: alanine dehydrogenase" amino acids 1 to 364 (364 residues), 509.9 bits, see alignment E=1.9e-157 PF05222: AlaDh_PNT_N" amino acids 4 to 137 (134 residues), 170.8 bits, see alignment E=2.7e-54 PF01262: AlaDh_PNT_C" amino acids 141 to 353 (213 residues), 290.2 bits, see alignment E=1.3e-90 PF00070: Pyr_redox" amino acids 170 to 219 (50 residues), 22.7 bits, see alignment 1.8e-08

Best Hits

Swiss-Prot: 62% identical to DHA_HALED: Alanine dehydrogenase (ald) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: K00259, alanine dehydrogenase [EC: 1.4.1.1] (inferred from 85% identity to swi:Swit_2063)

MetaCyc: 57% identical to L-alanine dehydrogenase subunit (Bacillus subtilis)
Alanine dehydrogenase. [EC: 1.4.1.1]

Predicted SEED Role

"Alanine dehydrogenase (EC 1.4.1.1)" in subsystem Pyruvate Alanine Serine Interconversions (EC 1.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JD97 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Ga0059261_3899 Alanine dehydrogenase (EC 1.4.1.1) (Sphingomonas koreensis DSMZ 15582)
MRVGVPKEIKNHEYRVGLTPPLVAELTASGHDVIVETKAGSGIDFEDSDYVAAGARIVAT
AAEVFAQADMIVKVKEPQPQEVAMLEPRHTLFTYLHLAPDPEQAAGLIKSGATCIAYETV
TANDRSLPLLKPMSEVAGRMSVQVGAHYLEKEQGGRGVLLGGVPGVAPAKVAILGGGVSG
INAAQMATGLRADVTIYDINNSRLAELDMHFGSQIKTAYASKAAIAAAVANAHLVIGAVL
VPGAAAPKLVTRDMLKTMKRGSVLVDIAIDQGGCFETSHATTHEDPVYEIDGVIHYCVAN
MPGAVARTSTFALNNATLPFVMKLANLGAEKAMAADPHLAAGLNVYKGAITHEAVAEALD
LQFTAWKP