Protein Info for Ga0059261_3828 in Sphingomonas koreensis DSMZ 15582

Annotation: two component transcriptional regulator, LuxR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF00072: Response_reg" amino acids 6 to 115 (110 residues), 102.3 bits, see alignment E=2.6e-33 PF00196: GerE" amino acids 141 to 196 (56 residues), 75.8 bits, see alignment E=2.4e-25

Best Hits

Swiss-Prot: 52% identical to FIXJ_AZOC5: Transcriptional regulatory protein FixJ (fixJ) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: None (inferred from 67% identity to cak:Caul_2344)

Predicted SEED Role

"Two-component nitrogen fixation transcriptional regulator FixJ" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WHT0 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Ga0059261_3828 two component transcriptional regulator, LuxR family (Sphingomonas koreensis DSMZ 15582)
MEKKLVHLVDDDPAIRRSVSFVLKTSGFEVKPYESGAIFLKEVRHADPGCILLDIRMPDK
DGLEVQRDLNAMGVSMPVVMLTGHGDVTAAVQAMKEGAVDFLEKPSDKADLLRAVEAAFA
RLNRTDDVAATESEAKVRIAALTPREQEVLEGLAQGLPNKTIAYDLGISPRTVEVHRANV
MTKLGVHTFPDALRIAFAAGLGKIAAS