Protein Info for Ga0059261_3779 in Sphingomonas koreensis DSMZ 15582

Annotation: Excinuclease ABC subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 729 TIGR00631: excinuclease ABC subunit B" amino acids 35 to 685 (651 residues), 1002.8 bits, see alignment E=3.2e-306 PF04851: ResIII" amino acids 44 to 168 (125 residues), 45.8 bits, see alignment E=2e-15 PF00270: DEAD" amino acids 52 to 115 (64 residues), 27 bits, see alignment E=1.1e-09 PF17757: UvrB_inter" amino acids 190 to 278 (89 residues), 109 bits, see alignment E=3.1e-35 PF00271: Helicase_C" amino acids 465 to 575 (111 residues), 68.6 bits, see alignment E=1.6e-22 PF12344: UvrB" amino acids 582 to 623 (42 residues), 78.5 bits, see alignment 8e-26 PF02151: UVR" amino acids 655 to 687 (33 residues), 35.8 bits, see alignment (E = 1.5e-12)

Best Hits

Swiss-Prot: 77% identical to UVRB_ZYMMO: UvrABC system protein B (uvrB) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 89% identity to sjp:SJA_C1-32800)

MetaCyc: 63% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WHM2 at UniProt or InterPro

Protein Sequence (729 amino acids)

>Ga0059261_3779 Excinuclease ABC subunit B (Sphingomonas koreensis DSMZ 15582)
MTIQIRTSLAEPETGPGFVPHRPARPEKSEGGKAFKLVSEYTPSGDQPTAIKELTEAALA
GERDQVLLGVTGSGKTFTMAKVIEALQRPALILAPNKILAAQLYGEFKSFFPENAVEYFV
SYYDYYQPEAYVPRSDTYIEKESSVNEAIDRMRHSATRSLLERDDVIIVASVSCLYGIGS
VETYSAMIFDLKKGQVADQREIIRKLVALQYKRNDAAFARGNFRVRGDSLEIFPSHYEDT
AWRISFFGDDIEEITEFDPLTGAKVANLDHIRVYANSHHVTPGPTLKQAMEAIKHELAER
LKELQAEGKLIEHQRLEQRTHFDLEMIAATGSCAGIENYSRFLTGRLPGEPPPTLFEYLP
ENALLFVDESHQTVPQIGAMARGDHRRKITLAEYGFRLPSCIDNRPLRFNEWDAMRPQTV
CVSATPGGWEMDQTGGVFSEQVIRPTGLIDPPVEIKPVEEQVQDLIVECRKTAEKGYRTL
VTTLTKRMAEDLTEYMHEAGIKVRYMHSDVETLERIELIRDLRMGVYDVLIGINLLREGL
DIPECGLVAILDADKEGFLRSETSLIQTIGRAARNVEGRVILYADRITGSMERALNETSR
RREKQEAYNREHGITPTTIKRNIGDIIAHVASKDQVTVEIEDGPAHMVGHNLRAYIEELE
KKMRDAAANLEFEEAGRLRDEIRSLEAEELGLPHDQHRAPVMGRSNEGKPGTRKGRFGKV
QRKWGGGRR