Protein Info for Ga0059261_3690 in Sphingomonas koreensis DSMZ 15582

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 PF14403: CP_ATPgrasp_2" amino acids 75 to 454 (380 residues), 547.1 bits, see alignment E=2e-168 PF04174: CP_ATPgrasp_1" amino acids 75 to 409 (335 residues), 479.8 bits, see alignment E=4e-148

Best Hits

Swiss-Prot: 51% identical to Y335_SYNY3: Uncharacterized protein sll0335 (sll0335) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 76% identity to swi:Swit_0519)

Predicted SEED Role

"Protein containing domains DUF404, DUF407"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JE40 at UniProt or InterPro

Protein Sequence (490 amino acids)

>Ga0059261_3690 Uncharacterized conserved protein (Sphingomonas koreensis DSMZ 15582)
MGTGRAFDEIWGHGGPDNPRADFTALSEWIAETPQSELHRRQQSAEATFRQLGITFAVYG
DSDASERIIPFDIVPRIFLHDEWQRLSEGLVQRVEAINAFLEDIYGERRILREGVLPEEL
ILKNPQFRPEVAGIRPPHGIWAHICGIDLVRTGPDEFWVLEDNARTPSGVSYMLENREAM
IRLCPELFRSFRVAAVDSYSDMLRETMRSVAPPRAGSGGVPVCVVLTPGHFNSAYYEHSF
LADTMGVELVEAADLVVDDDVVYMQTIAGRVKVDVIYRRIDDDFIDPLVFRPDSLLGVPG
LISAYRAGNVALINAPGNGIADDKAIYSYMPEIVKFYSGSEAKLPNVETWRCREPEALNY
VLDHLGELVVKLVDGSGGYGMLVGPTASKAEIEAFRGALKAEPHRYIAQPTLALSTVPTV
TETGLAPRHVDFRPFVLTGSDGVRVVPGGLTRVALKEGSLVVNSSQGGGTKDSFVLLPDG
DTQSQTQVLG