Protein Info for Ga0059261_3514 in Sphingomonas koreensis DSMZ 15582

Annotation: Obg family GTPase CgtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 TIGR02729: Obg family GTPase CgtA" amino acids 3 to 326 (324 residues), 425.7 bits, see alignment E=1.1e-131 PF01018: GTP1_OBG" amino acids 5 to 159 (155 residues), 188.9 bits, see alignment E=6.6e-60 PF01926: MMR_HSR1" amino acids 163 to 281 (119 residues), 95 bits, see alignment E=5e-31 TIGR00231: small GTP-binding protein domain" amino acids 164 to 321 (158 residues), 45.4 bits, see alignment E=7.7e-16 PF02421: FeoB_N" amino acids 164 to 319 (156 residues), 61.4 bits, see alignment E=1.2e-20

Best Hits

Swiss-Prot: 82% identical to OBG_SPHAL: GTPase Obg (obg) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K03979, GTP-binding protein (inferred from 82% identity to sal:Sala_1705)

Predicted SEED Role

"GTP-binding protein Obg"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WGZ3 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Ga0059261_3514 Obg family GTPase CgtA (Sphingomonas koreensis DSMZ 15582)
MHFLDQAKIYIKSGWGGGGAVGFRREKYIEYGGPDGGDGGKGGDIIFEAVPGLNTLIDFR
YTQHFRAQRGHGGSGSNKTGAGGDDLVIKLPVGTQILADDEERTLLADLTKAGQRIVFLK
GGDGGRGNASYKTSTNRTPRQHGTGWPGEEMYVWLRLKLLADAGLVGLPNAGKSTFINAV
TNAQAKVGAYAFTTTRPQLGVVRHKQNEFVIADIPGLIEGAAEGAGIGDRFLGHIERCKV
LLHLVDANDADVATSYRIVRDELDAYGAGLLDKKIIIALNKIDMLDDELIAALSAELEEA
SGAEVIPISGASGVGVDWALDKLLEAIGPDHARVTDDDEGEEEIEWSPI