Protein Info for Ga0059261_3507 in Sphingomonas koreensis DSMZ 15582

Annotation: His Kinase A (phospho-acceptor) domain/Response regulator receiver domain/Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase/CHASE3 domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details PF05227: CHASE3" amino acids 54 to 185 (132 residues), 34 bits, see alignment E=4e-12 PF02518: HATPase_c" amino acids 385 to 502 (118 residues), 74.2 bits, see alignment E=1.8e-24 PF00072: Response_reg" amino acids 529 to 637 (109 residues), 41.1 bits, see alignment E=2.8e-14

Best Hits

Predicted SEED Role

"sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JEA6 at UniProt or InterPro

Protein Sequence (654 amino acids)

>Ga0059261_3507 His Kinase A (phospho-acceptor) domain/Response regulator receiver domain/Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase/CHASE3 domain (Sphingomonas koreensis DSMZ 15582)
MSETSGLAQRIARLDWRAMLMILIAILGIGVLAALITNQRNADAERDAALARQSQSYEVM
ILAQSLAGTIASAEATLARYVVSGEESVGRDYVAEWQRAEGQLTLLARRTRDHDPEKDLI
AELRSAVAMRGKELSQIALNTRFNRNQAAYAFFDEARRSPVLPRIRTLLARIVAAERQLL
NERSRRARLTSAEAQEETRNLILFGMLIVIGAMILGWLNIRAIRERAAVAAEAQAQRERT
IELEAAVATATAGLQEEARERAAAEAQLRQAQKMEAVGQLTGGIAHDFNNMLAIVLGGLE
LAKRHLPEGASQSARHIDNASEGASRAAALTRRLLAFARAEPLTPQAIDPVELIAGMTNL
LERTLGEGVVVKTCAQATGWHVWADRHQLENALLNLAVNARDAMDSRGTLTISTGHTTLD
GEAATECGPGNYVTIAVSDTGAGMSPEVVERVFEPFFTTKPVGKGTGLGLSQIFGFVRQS
GGEIRIDSAPGEGTTVTLFLPCHGAAEPAAPDAAHRVGPSSEPHRALDILLVEDDPRVLA
ATLAALEELGHRPVACDDPLAAPRIVAGLHALDLIVSDVIMPGQTGPEMIAALDPQLDGV
AVLYVTGYAGDAADHERFGGRPVLRKPFTLSGLEAAIADAVANGRAAQTVTAVG