Protein Info for Ga0059261_3258 in Sphingomonas koreensis DSMZ 15582

Annotation: Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 PF02347: GDC-P" amino acids 1 to 446 (446 residues), 389.7 bits, see alignment E=1.8e-120 PF00266: Aminotran_5" amino acids 107 to 380 (274 residues), 24.1 bits, see alignment E=1.7e-09

Best Hits

Swiss-Prot: 80% identical to GCSPA_SPHWW: Probable glycine dehydrogenase (decarboxylating) subunit 1 (gcvPA) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K00282, glycine dehydrogenase subunit 1 [EC: 1.4.4.2] (inferred from 81% identity to sch:Sphch_1411)

Predicted SEED Role

"Glycine dehydrogenase [decarboxylating] (glycine cleavage system P1 protein) (EC 1.4.4.2)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 1.4.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.4.2

Use Curated BLAST to search for 1.4.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WG88 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Ga0059261_3258 Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain (Sphingomonas koreensis DSMZ 15582)
MRYLPLTPNDRQAMLAAVGAAAIDDLFVDVPESARLSGPIAGLPPHASELAVERHMAALA
RKNLSAGEAPFFLGCGAYRHHVPASVDHIIQRGEFLTAYTPYQPEIAQGTLQVMFEFQTQ
VARLLGTDVANASMYDGSTACWEAIGMARRITKRGKAILSGGLHPHYVSVANTMAKYTGD
TLVTAIPELTAEPDTDALIGMIDDETSCVVVQYPDILGRISDLSDLAAACQAKKALLVAV
VTEPVALGAIRSPGEMGADIVVGEGQSIGVGLQFGGPYVGLFGCKEKYVRQMPGRLTGET
VDAEGKRGFVLTLSTREQHIRREKATSNICTSSVLCALAWSIHMTLLGEKGLRQLAALNH
AGASAAADRLAKVPGVELVTPVFFNEFTLKLSKEARPIVRELADKGILAGVSLGRLYPGE
GALENGLVVAVTETTTAEDVETLAAALEEALA