Protein Info for Ga0059261_3257 in Sphingomonas koreensis DSMZ 15582

Annotation: glycine cleavage system H protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01597: GCV_H
  • amino acids 3 to 121 (119 residues), 155.2 bits, E=3.5e-50
• TIGR00527: glycine cleavage system H protein
  • amino acids 4 to 120 (117 residues), 155.7 bits, E=3.1e-50

Best Hits

Swiss-Prot: 67% identical to GCSH_BARBK: Glycine cleavage system H protein (gcvH) from Bartonella bacilliformis (strain ATCC 35685 / NCTC 12138 / KC583)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 72% identity to sjp:SJA_C1-27810)

MetaCyc: 56% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Sequence Analysis Tools

See A0A1L6JER8 at UniProt or InterPro

Protein Sequence (123 amino acids)

>Ga0059261_3257 glycine cleavage system H protein (Sphingomonas koreensis DSMZ 15582)
MSRYFTEDHEWIELDGEIATVGITDYAQSQLGDIVFVEVPDEGKQVSKGDDAAVVESVKA
ASDVYAPVSGTIVEGNPALADEPALVNEDPEGEGWFFKMTLSDTSELDGLMDEGKYQDFV
SKL