Protein Info for Ga0059261_3253 in Sphingomonas koreensis DSMZ 15582

Updated annotation (from data): homoserine kinase (EC 2.7.1.39)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00938.
Original annotation: homoserine kinase (EC 2.7.1.39)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00938: homoserine kinase
  • amino acids 1 to 309 (309 residues), 378.6 bits, E=1.2e-117
• PF01636: APH
  • amino acids 27 to 254 (228 residues), 142 bits, E=2.8e-45

Best Hits

Swiss-Prot: 50% identical to KHSE_GLUDA: Homoserine kinase (thrB) from Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5)

KEGG orthology group: K02204, homoserine kinase type II [EC: 2.7.1.39] (inferred from 59% identity to nar:Saro_1086)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-threonine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

See A0A2M8WG84 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Ga0059261_3253 homoserine kinase (EC 2.7.1.39) (Sphingomonas koreensis DSMZ 15582)
MAVYTQVSAEALAGFLARYDVGELVSAKGIAEGVENSNYLVETTRDRFILTLYEKRVEAA
DLPYFMGLLDHLAAKGLPVPPAIKDRGGVEIQELNGRPACLIKFLSGISLSHPTPAQARA
AGEAMAQMHRAVADFPLDRPNSMGVDTWQPLFEKCGHSLDQIVPGLYDDLGFAIARVVPA
WTRNDFDRCAIHADLFPDNVLMRGDQVTGLIDFYFACTDIRVYDLAVMHSAWSFDAHGRN
YDPAVGDALIAGYEASFPLTEVERAAFPTLAAGACIRFSLSRAWDWLNTPADALVMRKDP
LAYVRRLKHYAPDLVKHVA