Protein Info for Ga0059261_3203 in Sphingomonas koreensis DSMZ 15582

Annotation: ABC-type multidrug transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 47 to 67 (21 residues), see Phobius details amino acids 84 to 108 (25 residues), see Phobius details amino acids 128 to 154 (27 residues), see Phobius details amino acids 164 to 188 (25 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details PF01061: ABC2_membrane" amino acids 28 to 243 (216 residues), 93.9 bits, see alignment E=5.1e-31

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 69% identity to sjp:SJA_C1-22220)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JG76 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Ga0059261_3203 ABC-type multidrug transport system, permease component (Sphingomonas koreensis DSMZ 15582)
MAEQPRVQETTIAAPGVPVIRNVNWGGLWTLYVKEVRRFFKVQLQTIWAPAVTTLLFLVV
FTVALGGGGRTVVLDGKSIHFADFIAPGLIVMGMLQNAFANASFSLLVGKIQGTIVDYLM
PPLSTGELLAALCAGAVTRAFCVGATVWLAMALWPGVSVAPHHVWAILWFGFLGSLFLAL
LGVMTSIWAEKFDHAAAVTNFVVAPLALLSGTFYSVDKLAPTFQAISHANPFFYIISGFR
YGFLGVADSPIVLGSAVILGLNMLLGLACYALLRSGWKTRS