Protein Info for Ga0059261_3193 in Sphingomonas koreensis DSMZ 15582

Annotation: Dolichyl-phosphate-mannose-protein mannosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 10 to 28 (19 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 109 to 126 (18 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 162 to 193 (32 residues), see Phobius details amino acids 206 to 232 (27 residues), see Phobius details amino acids 290 to 313 (24 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details PF13231: PMT_2" amino acids 59 to 198 (140 residues), 54.1 bits, see alignment E=3.4e-18 PF02366: PMT" amino acids 75 to 230 (156 residues), 47.3 bits, see alignment E=3.1e-16 PF16192: PMT_4TMC" amino acids 241 to 412 (172 residues), 48.4 bits, see alignment E=1.2e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WG24 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Ga0059261_3193 Dolichyl-phosphate-mannose-protein mannosyltransferase (Sphingomonas koreensis DSMZ 15582)
MLDRLEQRPVLLALLIGIAALLLFGIGVQRPSILMFDEVHYVPAARVLIDLAHPVNMEHP
LLGKSLIALGMLIFGDNPIGWRAMSVLAGALTIVGVYSFARRLTGATRAGLFAALFAMLG
QLVFIQARIGMLDVFLGMLLVWAGVAFLRAMQGDSRRRAQFLLLASAIAFGGAVAVKWAA
VPYVALAGMAFLWLRRGHPERFGGTSWFAGLTILGCVSIATYFLTFAPAFFYTTNPMTLA
RLVPFQLEMWGLQTQVLAPHNYQSDWWSWPLMLRPIWYFYEPDQGAQRGVLLIGNPAIMW
GGLVAVAACWWAGLRDKAGAPLTAAILWTVSLGVWAVIPKSLGFYYYYYLPGIILSVVLA
VAFQHYAAKVKRNDEWYLVLCVGLFAYFYPILAALALPSERSFERWIWFPGWA