Protein Info for Ga0059261_3191 in Sphingomonas koreensis DSMZ 15582

Annotation: Glycosyltransferases involved in cell wall biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 transmembrane" amino acids 243 to 264 (22 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 7 to 176 (170 residues), 40.6 bits, see alignment E=4e-14 PF00535: Glycos_transf_2" amino acids 10 to 175 (166 residues), 91.7 bits, see alignment E=7.9e-30 PF04138: GtrA" amino acids 246 to 364 (119 residues), 75.5 bits, see alignment E=6e-25

Best Hits

KEGG orthology group: K00721, dolichol-phosphate mannosyltransferase [EC: 2.4.1.83] (inferred from 56% identity to eli:ELI_08330)

Predicted SEED Role

"Dolichol-phosphate mannosyltransferase (EC 2.4.1.83) homolog" (EC 2.4.1.83)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.83

Use Curated BLAST to search for 2.4.1.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WG20 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Ga0059261_3191 Glycosyltransferases involved in cell wall biogenesis (Sphingomonas koreensis DSMZ 15582)
MSAGPLELAVVIPTFNERRNVPILVAALDKALAGRRWEAIFVDDDSPDGTADAARELGRT
DTRVRVIQRIGRRGLSSATIEGMCATAAPHVAVIDGDMQHDETLLPKMLDSLQGDAGLDV
AIGSRFVDGGGTGEWDKDRVAKSAFATRLSRRVLKAELSDPMSGFFMIRSDVVREMVPHL
SAIGFKILLDIMTASPRALKFVELPYVFRTRQEGESKLDHVVAMEYLIALYDRMFGRVIP
VRFAMFSAIGALGAGVHFGALWLFYRLFGYSFLTGTIVATLVAMTFNFFLNNALTYRDAR
LKGFRPLLDGWISFCIVCSVGAIANVGVAAFLHDVQQAQWAPSALAGIVVAAVWNFALSS
RFVWGRY