Protein Info for Ga0059261_3089 in Sphingomonas koreensis DSMZ 15582

Annotation: single-stranded-DNA-specific exonuclease RecJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 transmembrane" amino acids 202 to 221 (20 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 34 to 579 (546 residues), 500.1 bits, see alignment E=3.2e-154 PF01368: DHH" amino acids 88 to 245 (158 residues), 71.1 bits, see alignment E=1.6e-23 PF02272: DHHA1" amino acids 333 to 452 (120 residues), 82.8 bits, see alignment E=5.1e-27 PF17768: RecJ_OB" amino acids 470 to 579 (110 residues), 52.1 bits, see alignment E=9.5e-18

Best Hits

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 76% identity to swi:Swit_4733)

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WFP7 at UniProt or InterPro

Protein Sequence (584 amino acids)

>Ga0059261_3089 single-stranded-DNA-specific exonuclease RecJ (Sphingomonas koreensis DSMZ 15582)
MTPVLNVHSSILGQPWRWRGLAADARDPGFAPDDLVTQLLLTRGCAREELEAHRSPSIRA
FMPDPSIFRDMDRAAERLADSVERREAVTIFGDYDVDGATSAALLIRLLRDLGLDPRAYI
PDRLMEGYGPSGEALVRLKREGADLIVTVDCGAMAFDALAEARDAGAEVIVVDHHKCASE
LPVALALVNPNRLDEDEGRQHGHLAAVGVAWLLGAALVRVLRGRGFFANRAEPKLLDLLD
IVALGTVADVAALKGLNRAFVAQGLKVMAQRRNTGMNALIEASRLTRAPTATDLGFALGP
RINAGGRVGKSDLGVRLLTTEDADEARGIAEELNRLNEERRAIEAEVQQSAEAIEAEGAV
AVVAARGWHPGVIGIVAGRLKERLGRPAIVIAIGEDGIGKGSGRSIAGVDLGAAILAAKE
AGLLIAGGGHAMAAGVTIAEDQIPALVAFLDEKLAETVERAAGERALLLDAVLAPGGVNP
ALVNAMEAGGPYGMGWPAPRVAAGPVRIIKCDVVGNGHVRAIVAGEDGRSIKCVAFRSAD
TPLGLALLGAPRDRRLWIAGRAKIDDWGARPAAEIHIEDAAWVE