Protein Info for Ga0059261_2718 in Sphingomonas koreensis DSMZ 15582

Annotation: Predicted thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 PF13279: 4HBT_2" amino acids 11 to 127 (117 residues), 44.5 bits, see alignment E=3.9e-15 PF01643: Acyl-ACP_TE" amino acids 13 to 128 (116 residues), 42.3 bits, see alignment E=1.2e-14 PF20791: Acyl-ACP_TE_C" amino acids 14 to 107 (94 residues), 24.3 bits, see alignment E=5.9e-09 PF03061: 4HBT" amino acids 19 to 77 (59 residues), 26.9 bits, see alignment E=1e-09

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 66% identity to sjp:SJA_C1-01540)

Predicted SEED Role

"FIG00636742: hypothetical protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WER3 at UniProt or InterPro

Protein Sequence (131 amino acids)

>Ga0059261_2718 Predicted thioesterase (Sphingomonas koreensis DSMZ 15582)
MARFTRTITAGPDDIDELGHVNNAVWVRWIQDVAVAHWHAVAAPEHHDAYIWVVTRHEID
YRGNVSQGETVTAETWVPDPPRGARFDRHMRFTGADGKVKVEAVSTWAMLDRATGRLVRV
RDEIAAPFLEG