Protein Info for Ga0059261_2714 in Sphingomonas koreensis DSMZ 15582

Annotation: drug resistance transporter, Bcr/CflA subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 60 to 77 (18 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 171 to 172 (2 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 384 to 403 (20 residues), see Phobius details PF06609: TRI12" amino acids 13 to 194 (182 residues), 36.1 bits, see alignment E=4.2e-13 TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 22 to 398 (377 residues), 204.3 bits, see alignment E=2e-64 PF07690: MFS_1" amino acids 27 to 369 (343 residues), 130.8 bits, see alignment E=8.7e-42 PF00083: Sugar_tr" amino acids 62 to 201 (140 residues), 38.3 bits, see alignment E=1.2e-13

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 51% identity to cak:Caul_4899)

Predicted SEED Role

"MFS family multidrug efflux protein, similarity to bicyclomycin resistance protein Bcr"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J5U9 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Ga0059261_2714 drug resistance transporter, Bcr/CflA subfamily (Sphingomonas koreensis DSMZ 15582)
MDAQTHQPGEAANRSPIPMGEFVALIAAIMALTALGIDSMLPALPAISDELGVTQPNHRQ
YVITAFMLGFAVAQLFHGPLADRFGRKPVIMGALACYVVTNAVAAFSGSFELLLLARAAS
GAAVAAGRVVTVALVRDCFQGRAMARVMSLAFMTFMIVPVLAPAWGQLMVIIFGSWRLIF
GGIAIIAALVLIWFTARMPETLPRDAVQPLDLRAIWRGYGKMFRDRWAVGYTFATTAISG
CFFSFIGSIQQIVYDVFKRPELLTLVFASVAGLMALGSFLNSRLVMRFGMRFLSHFALVA
TTSLAVIHLIVILLGGETLWVFIALQAPMMAAMGLANSNFSAMAMENMGEIAGTASSLQG
FIATMGAAVLGAVIGQSFDGTTVPLYLGFTVLGLAALVIVFVTERGKLFRRS