Protein Info for Ga0059261_2711 in Sphingomonas koreensis DSMZ 15582

Updated annotation (from data): homoserine dehydrogenase (EC 1.1.1.3)
Rationale: Divergent from characterized homoserine dehydrogenases but has the expected phenotype: important for fitness in the absence of amino acids and is most cofit with homoserine O-acetyltransferase Ga0059261_2301
Original annotation: homoserine dehydrogenase (EC 1.1.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03447: NAD_binding_3
  • amino acids 11 to 130 (120 residues), 56.5 bits, E=6.6e-19
• PF00742: Homoserine_dh
  • amino acids 139 to 317 (179 residues), 211.6 bits, E=1.1e-66
• PF01842: ACT
  • amino acids 351 to 413 (63 residues), 36.9 bits, E=3.7e-13

Best Hits

KEGG orthology group: K00003, homoserine dehydrogenase [EC: 1.1.1.3] (inferred from 73% identity to swi:Swit_4731)

Predicted SEED Role

"Homoserine dehydrogenase (EC 1.1.1.3)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 1.1.1.3)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• L-homoserine biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.3

Sequence Analysis Tools

See A0A1L6J6Q3 at UniProt or InterPro

Protein Sequence (430 amino acids)

>Ga0059261_2711 homoserine dehydrogenase (EC 1.1.1.3) (Sphingomonas koreensis DSMZ 15582)
MTEPLRVALAGLGTVGAGVIRLIDANAELIARRAGRPIEIVAVSARDRAKDRGVDITRFD
WVDDMTELARHPKADVVVELIGGSDGPALALARATLAAGKGLVTANKAMIAHHGLELAQV
AEKSDTPMKFEAAVAGGVPVIKGLREGAAANQIDRVYGILNGTCNFILSKMEAEGRDFGE
VLAEAQAAGFAEADPSFDIDGVDAAHKLSILASIAFGTQPAFGDVAIGGIRHLLAADIAE
AAALGYRIRLLGIADLSGNGLFQRVHPHLVPLSHPLAHVLGPTNAVVAEGNFVGRLLFQG
AGAGDGPTASAVVADLIDIARTEFGPPYAMPATSLAAEPVAPTGERRGRAYLRFTVADKV
GVLAEIAAAMRDAGVSIESLIQRGAMADGSVLVAIVTHEVPERSIAQALEKLRGSPSLAG
EPMWMHILGE