Protein Info for Ga0059261_2707 in Sphingomonas koreensis DSMZ 15582

Annotation: fructose-1,6-bisphosphatase, class II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00330: fructose-1,6-bisphosphatase, class II
  • amino acids 9 to 319 (311 residues), 336.1 bits, E=1.2e-104
• PF03320: FBPase_glpX
  • amino acids 11 to 319 (309 residues), 452.3 bits, E=3.4e-140

Best Hits

Swiss-Prot: 52% identical to GLPX_BACSU: Fructose-1,6-bisphosphatase class 2 (glpX) from Bacillus subtilis (strain 168)

KEGG orthology group: K02446, fructose-1,6-bisphosphatase II [EC: 3.1.3.11] (inferred from 82% identity to sjp:SJA_C1-07270)

Predicted SEED Role

"Fructose-1,6-bisphosphatase, GlpX type (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• gluconeogenesis I (11/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• gluconeogenesis III (10/12 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• oxygenic photosynthesis (11/17 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (12/19 steps found)
• superpathway of N-acetylneuraminate degradation (14/22 steps found)
• superpathway of hexitol degradation (bacteria) (10/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

See A0A1L6J5I5 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Ga0059261_2707 fructose-1,6-bisphosphatase, class II (Sphingomonas koreensis DSMZ 15582)
MQTASKVLDRVLVLEMVRVTEAAAIAASKLTGRGDEKAADAAAVEAMRASLNSLYMDGTV
VIGEGERDEAPMLYIGEKVGSAPGKGPKIDIALDPLEGTTICAKAGPNSLAVLAIAEEGN
LLNAPDVYMDKIAVGPGYPPNVIDLDKSPTANIEAIAAAKGVKPNEIIACVLDRPRHEKM
IAELRAIGCGVVLIGDGDVAGVIATTDPDTTIDVYMGQGGAPEGVLACAALRCVGGQFKG
RLVFRNEDERSRARRWGIEDLDKQYDLTELAKGDCIFAATGVTDGSLLEGVKRKPGKMTT
ESVVMRSSSGTVRWVRGEHRNG