Protein Info for Ga0059261_2317 in Sphingomonas koreensis DSMZ 15582

Annotation: A/G-specific DNA-adenine glycosylase (EC 3.2.2.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 TIGR01084: A/G-specific adenine glycosylase" amino acids 16 to 272 (257 residues), 299.2 bits, see alignment E=1.6e-93 PF00730: HhH-GPD" amino acids 47 to 164 (118 residues), 70 bits, see alignment E=3.2e-23 PF10576: EndIII_4Fe-2S" amino acids 201 to 217 (17 residues), 23.7 bits, see alignment (E = 7.2e-09) PF14815: NUDIX_4" amino acids 245 to 347 (103 residues), 64.7 bits, see alignment E=1e-21

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 65% identity to sch:Sphch_2078)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WDM7 at UniProt or InterPro

Protein Sequence (353 amino acids)

>Ga0059261_2317 A/G-specific DNA-adenine glycosylase (EC 3.2.2.-) (Sphingomonas koreensis DSMZ 15582)
VPANPSRDIANHVSGPLLRWYDANARVLPWRAPPGSPPPDPYRVWLSEVMLQQTQVATVI
PYFEKFTARWPDFASLAAVEDADLMSAWAGLGYYARARNLLAAARAIAGEHGGRLPADEA
ALRRLPGFGAYTAAAVAAIAFGQRAVVVDGNVERVVARLFAVADPLPGAKPRIRDLADSI
TPDARAGDFAQAMMDLGATICTPRSPRCLLCPLADRCEARAAATPEAFPVNAKKKARPVR
YGTFFWAERDGRVLLVRRPDTGLLGGMRAFPTGVWSESPPALADAPFAADWTLRNATVRH
VFTHFELIAALATATIGGHIDAPDGEWWPIADLDSAGLPTVFAKAVKAIGRSE