Protein Info for Ga0059261_2299 in Sphingomonas koreensis DSMZ 15582

Annotation: histidinol-phosphate aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 TIGR01141: histidinol-phosphate transaminase" amino acids 14 to 364 (351 residues), 307.4 bits, see alignment E=5.5e-96 PF00155: Aminotran_1_2" amino acids 32 to 360 (329 residues), 200.6 bits, see alignment E=6.8e-63 PF00266: Aminotran_5" amino acids 68 to 193 (126 residues), 29.2 bits, see alignment E=7.3e-11 PF01041: DegT_DnrJ_EryC1" amino acids 69 to 161 (93 residues), 23.8 bits, see alignment E=3.8e-09

Best Hits

Swiss-Prot: 65% identical to HIS8_SPHAL: Histidinol-phosphate aminotransferase (hisC) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 69% identity to sjp:SJA_C1-01210)

Predicted SEED Role

"Biosynthetic Aromatic amino acid aminotransferase beta (EC 2.6.1.57) @ Histidinol-phosphate aminotransferase (EC 2.6.1.9)" (EC 2.6.1.57, EC 2.6.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.57 or 2.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WDJ5 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Ga0059261_2299 histidinol-phosphate aminotransferase (Sphingomonas koreensis DSMZ 15582)
MTATNSKPQPKPWIMDIAPYVPGKSKTDDGRKAIKLSSNENPLGTSDKARAAFATAANSL
ERYPDASAVELREALAELHGLDAARIIYGNGSDEVLHLAAGAFAGPGDEIIYVNYGFTVY
PIATKRVGATPVVAADADYATDVDAILASVTDRTRIVFVANPNNPTGTYASREEIARLHA
GLRPDILLVLDHAYAEYIEGEIDDGGMELAKTQPNVLVTRTFSKLYGLAAERIGWGYGSA
EVIEAMHRIRLPFSITIAGTAAAIAALHDSAFVEHTRSHNAQWRRWFADEIAKLGNAGLR
AVPSQANFVLVLFEGALTAEAAYKGLMDEGYIVRWLPGQGLPHGLRITIGTEEETRAVAA
ILNKLVAETQQPATAG