Protein Info for Ga0059261_2298 in Sphingomonas koreensis DSMZ 15582

Updated annotation (from data): prephenate and/or arogenate dehydrogenase (EC 1.3.1.13)
Rationale: Important for fitness in defined media. 31% identical to arogenate dehydrogenase from Arabidopsis (Q9LMR3). The substrate could be prephenate (dehydrogenation first) or arogenate (transamination followed by dehydrogenation).
Original annotation: Prephenate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF07991: IlvN" amino acids 2 to 82 (81 residues), 21.2 bits, see alignment E=4.8e-08 PF03807: F420_oxidored" amino acids 3 to 87 (85 residues), 32.5 bits, see alignment E=2.7e-11 PF03446: NAD_binding_2" amino acids 4 to 101 (98 residues), 24.3 bits, see alignment E=7.2e-09 PF02153: PDH_N" amino acids 17 to 133 (117 residues), 68.3 bits, see alignment E=1.4e-22

Best Hits

KEGG orthology group: K00210, prephenate dehydrogenase [EC: 1.3.1.12] (inferred from 64% identity to pzu:PHZ_c2752)

Predicted SEED Role

"Prephenate and/or arogenate dehydrogenase (unknown specificity) (EC 1.3.1.12)(EC 1.3.1.43)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 1.3.1.12, EC 1.3.1.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.12 or 1.3.1.13 or 1.3.1.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J750 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Ga0059261_2298 prephenate and/or arogenate dehydrogenase (EC 1.3.1.13) (Sphingomonas koreensis DSMZ 15582)
MKRFGIIGFGRFGQLAARHLRDHFSVVVTDTADVGEAAAAIGVKTGSLADAADCDVVMLA
VPVQAMAATIAAIAPLVRPGALVLDVASVKMLPARWMLEALPESVDIVATHPLFGPQSAR
GGLEGQPLVVCAVRGERHHKVAEFGRSLGLSVSITTAEEHDREMAYVQALTHLIGRALVN
IRIPDEELKTNSYQHLLELCGLIRDDSKELFFAIQNLNPYAEEITRQFIAEANGLLAESL
KAGNRSAAD