Protein Info for Ga0059261_2289 in Sphingomonas koreensis DSMZ 15582

Annotation: Glycine/D-amino acid oxidases (deaminating)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 transmembrane" amino acids 17 to 32 (16 residues), see Phobius details PF01266: DAO" amino acids 15 to 237 (223 residues), 33.9 bits, see alignment E=2.7e-12 PF04820: Trp_halogenase" amino acids 15 to 472 (458 residues), 630.8 bits, see alignment E=1.5e-193

Best Hits

KEGG orthology group: K14266, FADH2 O2-dependent halogenase I [EC: 1.14.14.7] (inferred from 59% identity to rfr:Rfer_1114)

Predicted SEED Role

"Tryptophan halogenase"

Isozymes

Compare fitness of predicted isozymes for: 1.14.14.7

Use Curated BLAST to search for 1.14.14.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WDI7 at UniProt or InterPro

Protein Sequence (512 amino acids)

>Ga0059261_2289 Glycine/D-amino acid oxidases (deaminating) (Sphingomonas koreensis DSMZ 15582)
MEAGQTGTGNPPIRRIVIVGGGTAGWMTAALLSKLLFRGYDITLVESDEIGIIGVGEATI
PGIKDYNHLAGIDLTEMIRATQATFKLGIEFVNWREPGFRYIHGFGKIGTDLMWLHPHQL
WLKLAAMGQAKHFDLYSLNTLAARQNKFCFPDPRNPGSPMGHLDYAYHFDASLYARFLRG
RSEAQGVTRTEGRIVEVRQRPEDGFVESVVLADGQTVSGDLFVDCSGMRSLLLGQTLGVG
YEDWSHWLPCDRALAVPCESVSPLTPYTRSTAHGAGWQWRIPLQHRIGNGHVYSSAHVSD
DEAADVLLANLDGKALADPRPVRFAPGKRHKAWEKNVVAIGLSSGFLEPLESTSIHLIQT
GILKLVALFPGQGFNAADIAEYNRQHNFEFDDVRDFIIAHYKVTNREDTPFWAHVRHMEV
PDSLAERLELFRASARFFVHGKAELFREESWVQVLLGQGMAMTYDPVVDMIPDEDVIAFM
RDIEEVNADVAAAMPTHQAFIDRHCKAPSLAS