Protein Info for Ga0059261_2184 in Sphingomonas koreensis DSMZ 15582

Annotation: Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02630: SCO1-SenC" amino acids 39 to 174 (136 residues), 154.7 bits, see alignment E=6.9e-50

Best Hits

Swiss-Prot: 37% identical to SCO22_RICBR: SCO2-like protein RBE_0699 (RBE_0699) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K07152, (no description) (inferred from 55% identity to swi:Swit_2820)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WD84 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Ga0059261_2184 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems (Sphingomonas koreensis DSMZ 15582)
MNRLLIPALALAFALVSCGGGTSGSKSLADAPLAGASIGGPFTLVNGDGKTVKDSDFTGK
YRIMYFGYTFCPDVCPVDVQNIGGAMKLLDKSNPKLSEQIVPIFVTIDPARDTPKVVKEF
AAAFHPRMVGLTGTPAQVDAAAKVYRVPYAKRETPSGYLMDHGRQAYLIGPKGEPIALLP
QDQNPQAIVAEIERWIG