Protein Info for Ga0059261_2038 in Sphingomonas koreensis DSMZ 15582

Annotation: Putative threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 64 (25 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 112 to 138 (27 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details PF01810: LysE" amino acids 16 to 202 (187 residues), 138.9 bits, see alignment E=7.6e-45

Best Hits

KEGG orthology group: None (inferred from 53% identity to npp:PP1Y_AT35221)

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J6J1 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Ga0059261_2038 Putative threonine efflux protein (Sphingomonas koreensis DSMZ 15582)
MTLHTWWLYVTAVFLIAATPGPNMLHVMAQSIHHGTRRSIASMAGLMTAVLTCLFASAAG
LGALLKASPMLFDVLRYAGVAYLVWLGIKAWRAPVADSDPDAEKPAPPSLRALYATGLGT
GFANPKLIVFAAALFPQFIDTGKPFAPQLAILVASFIVIETFWYSVYALGGRSLAAWLAP
ANRQRLFNRITGGIFVAFGAALFGHRV