Protein Info for Ga0059261_1947 in Sphingomonas koreensis DSMZ 15582

Annotation: signal peptidase I, bacterial type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details PF10502: Peptidase_S26" amino acids 24 to 261 (238 residues), 150.9 bits, see alignment E=1.7e-48 TIGR02227: signal peptidase I" amino acids 28 to 263 (236 residues), 141.7 bits, see alignment E=9.5e-46

Best Hits

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.89

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J667 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Ga0059261_1947 signal peptidase I, bacterial type (Sphingomonas koreensis DSMZ 15582)
MDDIAPADSGTKPAHTPKPRSEWRDTLSFLVKLAILVFVVRSFIFAPFSIPSGSMLPRLL
VGDYLFITKWNYGYSKHSLPWSLPLIPGRIFAEDPARGDVVVFKAPPSNDTDWIKRVIGL
PGDTVQMRNGQLILNGQAIPKQRIGDFVIPITPNFPVEGPGTGGGCNPMFVEPGPNGTQV
CRIPRFRETLPGGKNYEVLDEGYRPDADDTELFTVPAGHVFLMGDNRDDSADSRFPQPPE
GQGIRFVPMENLQGKAVVSFWSTDGGAQWLLPWTWFSAARFDRIGEGF