Protein Info for Ga0059261_1942 in Sphingomonas koreensis DSMZ 15582

Updated annotation (from data): putative efflux pump, required for thallium (I) resistance
Rationale: PFam PF02694.11 (UPF0060). conserved specific phenotype of UPF0060
Original annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details PF02694: UPF0060" amino acids 2 to 106 (105 residues), 109.2 bits, see alignment E=6.3e-36

Best Hits

Swiss-Prot: 75% identical to Y701_SPHAL: UPF0060 membrane protein Sala_0701 (Sala_0701) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K09771, hypothetical protein (inferred from 75% identity to sal:Sala_0701)

Predicted SEED Role

"Protein of unknown function UPF0060"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WCK3 at UniProt or InterPro

Protein Sequence (109 amino acids)

>Ga0059261_1942 putative efflux pump, required for thallium (I) resistance (Sphingomonas koreensis DSMZ 15582)
MTLFAYVLAALAEIAGCFAFWAWLRLGKSPWWLVPGIAALIVFAWALTWIETSHAGRAYA
AYGGIYITAAILWLWAVEGARPDRWDVIGGAVALAGTAIILFGPRSASA