Protein Info for Ga0059261_1912 in Sphingomonas koreensis DSMZ 15582
Annotation: Nitroreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 57% identical to Y3605_XANCP: Putative NADH dehydrogenase/NAD(P)H nitroreductase XCC3605 (XCC3605) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 64% identity to sal:Sala_2070)MetaCyc: 43% identical to putative malonic semialdehyde reductase (Escherichia coli K-12 substr. MG1655)
RXN-8974 [EC: 1.1.1.298]
Predicted SEED Role
"Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-)" (EC 1.-.-.-)
MetaCyc Pathways
- 3-hydroxypropanoate cycle (9/13 steps found)
- β-alanine degradation III (1/2 steps found)
- uracil degradation III (3/5 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (12/18 steps found)
- superpathway of the 3-hydroxypropanoate cycle (10/18 steps found)
- glyoxylate assimilation (6/13 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-
Use Curated BLAST to search for 1.-.-.- or 1.1.1.298
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A2M8WCG9 at UniProt or InterPro
Protein Sequence (197 amino acids)
>Ga0059261_1912 Nitroreductase (Sphingomonas koreensis DSMZ 15582) MGTPLNEAGLDTIFRTARTYNGYLPGEVTEADIGAIYDLLKMGPTSANMQPARFVWCLSQ EAKDKLAACASEKNAPKISAAPAAVVIGMDYDFHEQLPWLFPHTDAKSWFEGPQANRVEG ALRNSSLQGAYFLIAARALGWDTGPMSGFDAAKVDAAFFADQPSVHANFIATFGKGDPAS IFGRSPRPEFGQFNQIA