Protein Info for Ga0059261_1895 in Sphingomonas koreensis DSMZ 15582

Updated annotation (from data): 2-keto-3-deoxyxylonate dehydratase (EC 4.2.1.141)
Rationale: Specifically important in carbon source D-Xylose. 31% identical to HVO_B0027, which is 2-keto-3-deoxyxylonate dehydratase (see PMC2785657). Ga0059261_1895 is also 61% identical to xylX from Caulobacter crescentus, which is also required for xylose utilization (PMC1855722) and is believed to have this activity as well.
Original annotation: Fumarylacetoacetate (FAA) hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF01557: FAA_hydrolase" amino acids 177 to 350 (174 residues), 33.1 bits, see alignment E=2.4e-12

Best Hits

KEGG orthology group: None (inferred from 62% identity to bsb:Bresu_2942)

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.141

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J6G9 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Ga0059261_1895 2-keto-3-deoxyxylonate dehydratase (EC 4.2.1.141) (Sphingomonas koreensis DSMZ 15582)
VPEAFDVSALPEDAGQATLAGRVMLAEGPVPVIVREGRVHDVSTVAATTADLFDLPDPAS
AAGKYLCDVTDLTIGGGAYALLAPIDLQCVKACGVTFAVSALERVIEERARGDAGQAAAI
RAELEEKIGGGIRSVVPGSADAAKLKAVLIDAGMWSQYLEVAIGPDAEVFTKAPVLSSVG
WGAEIGIRSDSSWNNPEPEVVVIANAAGKVIGATLGNDVNLRDFEGRSALLLGKAKDNNA
ACAIGPFVRLFDAQFGIDDVRNAELDLLIEGPEGYRLEGHSSMNQISRDPLELVRQTLSE
HQYPDGFALFLGTLFAPVQDRDDPGRGFTHKIGDTVRIRSRKLGTLTNRVTTSKDAAPWT
FGIRELYRSIAARTAA