Protein Info for Ga0059261_1890 in Sphingomonas koreensis DSMZ 15582

Annotation: transcriptional regulator, LacI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF00356: LacI" amino acids 13 to 58 (46 residues), 65.8 bits, see alignment 4.7e-22 PF00532: Peripla_BP_1" amino acids 71 to 307 (237 residues), 84.1 bits, see alignment E=2.5e-27 PF13407: Peripla_BP_4" amino acids 72 to 319 (248 residues), 53 bits, see alignment E=7.9e-18 PF13377: Peripla_BP_3" amino acids 181 to 343 (163 residues), 139.3 bits, see alignment E=2.7e-44

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 55% identity to sjp:SJA_C1-12950)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WCI1 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Ga0059261_1890 transcriptional regulator, LacI family (Sphingomonas koreensis DSMZ 15582)
MSRSTRKTMGGVTVQDVARAAGVSAMTVSRVMNGGTNVRADTRKAVLAAVDQLDYRPNAA
ARSLAAGGIAQIGLLYANPSAGYLSQFLIGALETARRAGSHLVLEACEDDSPQAEAEAVR
QLIDARVRGVVLPPPLSESAVVRTALAQAGIPWAAIAMGSQEAGTLNVRIDDFEAARAIT
RHLIELGHREIGFIRGHPNQVASAERHRGFVAALEEAGIDPASARIEQGLFTYRSGIDAA
ERILAASGAPTAIFASNDDMAAAAVGVAHRHGLHVPGDLSIVGFDDTAIATSIWPALTTI
RQPISAMAEAAITMLLRRLRERPGEAEATEEEVLPYELVLRESAGPRTR