Protein Info for Ga0059261_1778 in Sphingomonas koreensis DSMZ 15582

Updated annotation (from data): beta-fructosidase for D-raffinose catabolism (EC 3.2.1.26)
Rationale: Specifically important for: D-Raffinose pentahydrate. Uncertain if it acts on raffinose or sucrose (raffinose could be cleaved to galactose + sucrose first). Alternatively, SEED suggests that it hydrolyzes sucrose-6-phosphate, but the basis for this is unclear.
Original annotation: Beta-fructosidases (levanase/invertase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00251: Glyco_hydro_32N" amino acids 30 to 342 (313 residues), 292.2 bits, see alignment E=6.1e-91 PF08244: Glyco_hydro_32C" amino acids 345 to 494 (150 residues), 104.1 bits, see alignment E=7.8e-34

Best Hits

Predicted SEED Role

"Sucrose-6-phosphate hydrolase (EC 3.2.1.B3)" (EC 3.2.1.B3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.26 or 3.2.1.B3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WC72 at UniProt or InterPro

Protein Sequence (502 amino acids)

>Ga0059261_1778 beta-fructosidase for D-raffinose catabolism (EC 3.2.1.26) (Sphingomonas koreensis DSMZ 15582)
MKKLAILLTAAAVLASAASAQQADVRPGYHYGPARNWMNDPNGLVYYDGEYHLFYQYNPH
GDRWGHMNWGHAVSRDLVNWEELPVAIPETDVMAFSGTAVIDWNNTTGFGKNGKPPMIAI
YTGHDPKTERQSQYLAYSNDRGRTFTIHGEVLNAGNEKHFRDPKVFWHAPTRRWVMVVLK
AAANTAEIYTSPNLKDWTHRSSFGPAGGRGKFWECPDLFELPVEGGAPGETRWVLSINLG
DNAIGGGSGGQYFVGDFDGEKFTLVPGWPAAPQWMDYGADFYATISWNDMPKGDPRRVWM
GWANDWRYAEAIPTWPARGIMTVARTVALRKTAEGYHLLQAPVRELATLRGTPQRAPALA
LSETPVPLPIEGGKADIELELDTGTADQVSIALTDGQGWQTRIGVNPTVNEVFVDRTRSG
PHFHDGFANRHVAPVDLKSRKVKLRVLADESIVEVFVNDGRQTITDRFYRGGGALTWSAT
ARGGKATMNLTAWPMRSMESRK