Protein Info for Ga0059261_1777 in Sphingomonas koreensis DSMZ 15582

Updated annotation (from data): D-fructose transporter, sugar porter family
Rationale: Specific phenotype on fructose and raffinose; during growth on raffinose, it is probably cleaved to sucrose in the periplasm (by Ga0059261_1166), so this probably is important on raffinose because of the fructose uptake
Original annotation: MFS transporter, sugar porter (SP) family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 356 to 379 (24 residues), see Phobius details amino acids 396 to 435 (40 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 20 to 450 (431 residues), 365 bits, see alignment E=3.1e-113 PF00083: Sugar_tr" amino acids 28 to 452 (425 residues), 363.7 bits, see alignment E=3e-112 PF07690: MFS_1" amino acids 30 to 393 (364 residues), 111 bits, see alignment E=1.3e-35 PF05631: MFS_5" amino acids 66 to 191 (126 residues), 27.5 bits, see alignment E=3e-10 PF06609: TRI12" amino acids 70 to 225 (156 residues), 33.4 bits, see alignment E=3.8e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WC44 at UniProt or InterPro

Protein Sequence (458 amino acids)

>Ga0059261_1777 D-fructose transporter, sugar porter family (Sphingomonas koreensis DSMZ 15582)
MHSVSASFAGAPDEEARATVAIILSAAGAALGGLLFGFDTAVISGATQALQLQFGLTDAM
LGFTVASALIGTVLGSLIAGAPADRFGRKGVMLTVAIAYVVSSLGTGLAPDLNAFLVFRF
MGGLAIGAASVVTPIYIAEVSPARFRGRLVAMNQLNIVLGILIAFLSNYIIAGLVQYDVA
WRWMFGIVAVPSTIFLLVTLLLPESPRWLAIHGQADRARDVMQRLGFADPRAELARIELA
EAREEAAGKPRLFQRSHFTPVACAIAIAMFNQLSGINALLYYAPRIFELAGAGADSALLQ
SIAVGGTNLVFTVAALFLIDRFGRRPLLFVGSVICAATLLLVGWQLESAKPDGTLILFGL
LGFIAAFAMSQGAVIWVFISEVFPSAVRGKGQALGSTTHWVMAAAITWAFPVFAASVGGW
VFAFFGAMMLLQLLWTWKFMPETNGIALEDMNLGSARA