Protein Info for Ga0059261_1645 in Sphingomonas koreensis DSMZ 15582

Updated annotation (from data): N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)
Rationale: Specifically important for utilizing N-Acetyl-D-Glucosamine. Automated validation from mutant phenotype: the predicted function (NAG6PDEACET-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: N-acetylglucosamine-6-phosphate deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00221: N-acetylglucosamine-6-phosphate deacetylase
  • amino acids 4 to 372 (369 residues), 306.1 bits, E=1.7e-95
• PF01979: Amidohydro_1
  • amino acids 51 to 374 (324 residues), 76.3 bits, E=1.4e-25

Best Hits

KEGG orthology group: K01443, N-acetylglucosamine-6-phosphate deacetylase [EC: 3.5.1.25] (inferred from 59% identity to nar:Saro_2414)

Predicted SEED Role

"N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.1.25)

MetaCyc Pathways

• N-acetylglucosamine degradation I (2/2 steps found)
• N-acetylglucosamine degradation II (2/3 steps found)
• peptidoglycan recycling I (9/14 steps found)
• superpathway of N-acetylneuraminate degradation (14/22 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (1/4 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (2/6 steps found)
• N-acetyl-D-galactosamine degradation (1/5 steps found)
• chitin derivatives degradation (2/8 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.25

Sequence Analysis Tools

See A0A2M8WBX5 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Ga0059261_1645 N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25) (Sphingomonas koreensis DSMZ 15582)
MRIRLENGRIVTPQGVLDGTDVTVADGTIIALTPASGSGVERKIDLGGGWLLPGFIDTQV
NGGGGVLFNDQADVDAIAAIGAAHARFGTTAFLPTLISDTPDQIAAALDAVDAAIEQGVP
GVVGIHVEGPFINEVKRGIHEARRIRRLDADTLALFTAPRRGRVMLTLAPELCDTDDVRT
LVKHGVIVSAGHTNATYDEMMAAIGAGLTGFTHLFNAMSPLHHRNPGAVGAAFDSESWCG
MIVDDAHLHPAVVRLAVRAKGIERLMLVTDAMPSVGTGDTEFMLQGKRIMVRNGVCLFED
GTLAGTHLDMASALRNTVEVTGLSVPDVAVMASTTPAHFLSLDRYGALAPGKRADWVWLD
KDLQPRGTWIGGEPVADAEEFARAAQ