Protein Info for Ga0059261_1644 in Sphingomonas koreensis DSMZ 15582

Updated annotation (from data): Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6)
Rationale: Specifically important for utilizing N-Acetyl-D-Glucosamine. Automated validation from mutant phenotype: the predicted function (GLUCOSAMINE-6-P-DEAMIN-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: Predicted phosphosugar isomerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01380: SIS
  • amino acids 52 to 173 (122 residues), 57.9 bits, E=4.9e-20
  • amino acids 208 to 290 (83 residues), 43 bits, E=2e-15

Best Hits

KEGG orthology group: K00820, glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC: 2.6.1.16] (inferred from 66% identity to aex:Astex_3364)

Predicted SEED Role

"Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6)" in subsystem Chitin and N-acetylglucosamine utilization or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.99.6)

MetaCyc Pathways

• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• N-acetylglucosamine degradation I (2/2 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• N-acetylglucosamine degradation II (2/3 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
• chitin biosynthesis (6/9 steps found)
• O-antigen building blocks biosynthesis (E. coli) (7/11 steps found)
• superpathway of N-acetylneuraminate degradation (14/22 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis III (2/6 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (2/6 steps found)
• chitin derivatives degradation (2/8 steps found)
• chitin degradation I (archaea) (1/7 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (9/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (9/33 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Glutamate metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.16

Use Curated BLAST to search for 2.6.1.16 or 3.5.99.6

Sequence Analysis Tools

See A0A2M8WBQ4 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Ga0059261_1644 Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (Sphingomonas koreensis DSMZ 15582)
MVPNAAGASLGTLMEREAAEAGAAVSRMLAANRDAIERVAARLRASPPAVVVTCARGSSD
HAATYAKYLIETLTGVPTASAALSVASLYDAPVAPGNGLCLAISQSGKSPDLLATVEHQR
KAGAFVVAMVNAEDSPLAALADIVIPLKAGPERSVAATKSYICSLAAIAALVAAWAQDEA
LETAVADLPAQLERAFALDWSAAVTALTGASGLFVLGRGYGYGIAQEAALKFKETCALHA
ESFSAAEVRHGPMAIVGEAFHVLAFASSDRAGESVRETVAEFRSRGAEVLLADPAARQAG
LPAIAAHPAIEPILIVQSFYKMANALALARGCDPDSPPHLNKVTETL