Protein Info for Ga0059261_1643 in Sphingomonas koreensis DSMZ 15582

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details transmembrane" amino acids 12 to 26 (15 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 327 to 350 (24 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 2 to 222 (221 residues), 39 bits, see alignment E=6.8e-14 PF16401: DUF5009" amino acids 4 to 93 (90 residues), 29.3 bits, see alignment E=6.3e-11

Best Hits

Predicted SEED Role

"N-acetylglucosamine related transporter, NagX" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WBQ5 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Ga0059261_1643 Uncharacterized conserved protein (Sphingomonas koreensis DSMZ 15582)
MRLISLDVLRGLTVAGMILVNAAAGMKYGAEADVAPILLHKSWEGLTLADLVFPAFLTMV
GIAIPFSLRQRAATGAPTGPILSRTGRLILLGFILSNLYWFADFGDRDWRLFGVLQRIGL
VYGACALLFLFAGPRVRMALIAVLLIGYWPLALLPALDGLPNDIWQRGHNFVASVDRVLL
GDHLYVKGPEGYDPEGILGTLPAIAQGLIGIAIGELLLKREGQRTRLLLAAGAAMLAAGI
AWSFAFPIVKDIWSSSFVLVTAGITVLTLAVLHHVLDREGRAPGIAATAMLAFGANAIAA
YTLHQVTSGVVTWDLLLLPFHATRAAIGDPIASLFPVLIYIVLIWAAMEWLRRKGWIIKI