Protein Info for Ga0059261_1577 in Sphingomonas koreensis DSMZ 15582

Updated annotation (from data): L-glutamine and L-histidine transporter
Rationale: Specific phenotype on glutamine; also important for histidine utilization; detrimental to fitness on some other amino acids (proline, alanine) which may indicate that it likes these amino acids
Original annotation: amino acid/polyamine/organocation transporter, APC superfamily (TC 2.A.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 260 to 285 (26 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details amino acids 359 to 378 (20 residues), see Phobius details amino acids 384 to 405 (22 residues), see Phobius details amino acids 417 to 436 (20 residues), see Phobius details amino acids 442 to 460 (19 residues), see Phobius details PF13520: AA_permease_2" amino acids 27 to 442 (416 residues), 189.5 bits, see alignment E=1e-59 PF00324: AA_permease" amino acids 31 to 406 (376 residues), 139.9 bits, see alignment E=1.1e-44

Best Hits

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 75% identity to sal:Sala_1704)

Predicted SEED Role

"amino acid transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WBJ1 at UniProt or InterPro

Protein Sequence (470 amino acids)

>Ga0059261_1577 L-glutamine and L-histidine transporter (Sphingomonas koreensis DSMZ 15582)
MAGGLFRTKRVKDAAEQAPEHRLAATLSWPHLVALGVGAIVGTGILTLIGVGAGKAGPAV
IMSFVIAGAICACAALAYAEMATMMPASGSAYAYSYAVLGEIIAWVVGWSLILEYSLVVS
TVAVGWSGYAAPLLHAWTGMPLELMAGPHANGIVNLPAIFIIAVVAGLLCLGTKESATLN
AALVVVKIIALAVFVAVALPYFNGANLEPFAPFGFAKTISPDGVERGVMAAAAIIFFAFY
GFDAISTAAEETKNPGRDLAIGIVGSMIACVAIYMLVAVAAVGATPFTHFANSPEPLALI
LRDLGRPGFATFLAVSAIIALPTVLLGFLFGQSRIFFTMARDGMLPIGLAKVSKRGSPVR
ITLFTAAIVAVIAGLLPIDEIAALANAGTLAAFTAVAVCMMVLRVRAPDMPRMFRTPLWW
LVGAIAVLGCIYLFFSLPVKTQLWFLAWNALGVVIYFAYARPRVSAKGIE