Protein Info for Ga0059261_1565 in Sphingomonas koreensis DSMZ 15582

Annotation: cytochrome bo3 quinol oxidase subunit 1 apoprotein (EC 1.10.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 668 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 113 to 137 (25 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 239 to 265 (27 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details amino acids 392 to 414 (23 residues), see Phobius details amino acids 426 to 451 (26 residues), see Phobius details amino acids 463 to 484 (22 residues), see Phobius details amino acids 504 to 527 (24 residues), see Phobius details amino acids 597 to 615 (19 residues), see Phobius details amino acids 620 to 640 (21 residues), see Phobius details TIGR02843: cytochrome o ubiquinol oxidase, subunit I" amino acids 13 to 656 (644 residues), 1105.8 bits, see alignment E=0 PF00115: COX1" amino acids 67 to 514 (448 residues), 489.8 bits, see alignment E=3.8e-151

Best Hits

Swiss-Prot: 64% identical to CYOB_ECOL6: Cytochrome bo(3) ubiquinol oxidase subunit 1 (cyoB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02298, cytochrome o ubiquinol oxidase subunit I [EC: 1.10.3.-] (inferred from 91% identity to sal:Sala_1507)

MetaCyc: 64% identical to cytochrome bo3 subunit 1 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit I (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J8N9 at UniProt or InterPro

Protein Sequence (668 amino acids)

>Ga0059261_1565 cytochrome bo3 quinol oxidase subunit 1 apoprotein (EC 1.10.3.-) (Sphingomonas koreensis DSMZ 15582)
MTPHPAPEAGPILGRLSLEAIPLHEPILIATFAVVAIGGLAVLALLTKYRLWGYLWTEWF
TTVDHKKIGIMYMILGLIMFLRGFADAIMMRLQQALAFGGSEGYLNSHHYDQIFTAHGVI
MIFFVAMPFITGLMNYIVPLQIGARDVSFPFLNNFSFWMTTAGAVLTMVSLFIGEYAQTG
WLAYPPLSGIAYSPNVGVDYYIWSLQIAGVGTTLSGINLIVTILKLRAPGMGLMKMPVFT
WTSLCSNILIVASFPILTATLVLLSLDRYVGTNFFTNDFGGSPMMYVNLIWIWGHPEVYI
LILPLFGVFSEVTSTFSNKRLFGYTSMVYATVCITILSYLVWLHHFFTMGSGASVNSFFG
ITTMVISIPTGAKLFNWLFTMYRGRIRFELPMMWTIAFMLTFTIGGMTGVLLAVPPADFV
LHNSLFLIAHFHNVIIGGVLFGLFAAINYWWPKAFGFKLDKKWGLVSFWCWVVGFWLAFT
PLYILGLMGVTRRMRVFDDPSLQIWFVIAGIGAAVIAAGIGAMLIQFAVSIWKRKELAEP
TGDPWNGRTLEWATSSPPPDYNFAFTPVIHDLDAWYDMKARNAQRPVSGFRDIHMPSNTG
SGIILSGFCLVMGFALVWHIWWLAAASFVAVVAGAIYHTFNYKRDFHIPAATVIGVEDAR
TRQLAPGA