Protein Info for Ga0059261_1503 in Sphingomonas koreensis DSMZ 15582

Annotation: replicative DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF00772: DnaB" amino acids 18 to 119 (102 residues), 80.6 bits, see alignment E=1.2e-26 TIGR00665: replicative DNA helicase" amino acids 19 to 494 (476 residues), 493.2 bits, see alignment E=3.4e-152 PF03796: DnaB_C" amino acids 196 to 493 (298 residues), 328.9 bits, see alignment E=3.1e-102 PF13481: AAA_25" amino acids 200 to 390 (191 residues), 45.1 bits, see alignment E=1.4e-15

Best Hits

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 65% identity to sal:Sala_0766)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WBE1 at UniProt or InterPro

Protein Sequence (504 amino acids)

>Ga0059261_1503 replicative DNA helicase (Sphingomonas koreensis DSMZ 15582)
MATLATLPTAPADAAPRLPQNVEAEAALLGAMMIDNRLADDIVEVIQDQHFFEPVHGRIF
KAIKTLRKNDMLATPVTLKPLFEKDEGMATLGGPAYLAQLTGSGAGLIGARQFARQIYDL
ALLRELVTVGRNMVEKALDTSEDVNPREQIDKAEEALFKVAADGGTANTVKTFNEATKIA
LENAKKAQSAGGGVAGVTTGFDSVNGRIGGLHHSDLIILAGRPGMGKTSLVTNIAYNAAR
RLMDDIRLGIPPKQSIGAKVAFFSLEMSADQLALRILSEQSRIASEALRMGNISKAEFAQ
LAAAAADLEQLPLYIDDTAGLTISALHSRVRRLQSKHDGELGMVIVDYLQLLQGSGNNRE
GNRVQEISEISRGLKTLAKDINVPVVALSQLSRAVESREDKRPMLSDLRESGSIEQDADM
VWFVFREDYYVAAREPKRPREGDDPKTFEDHAKWALEMERVYGLAELIIAKQRHGATGKV
LLRFESSFTRFSDYVGDVEMPYGE