Protein Info for Ga0059261_1277 in Sphingomonas koreensis DSMZ 15582

Annotation: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF00561: Abhydrolase_1" amino acids 28 to 282 (255 residues), 138 bits, see alignment E=6.8e-44 PF12146: Hydrolase_4" amino acids 28 to 128 (101 residues), 42.1 bits, see alignment E=9.8e-15 PF12697: Abhydrolase_6" amino acids 30 to 288 (259 residues), 83.2 bits, see alignment E=6.4e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WAR4 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Ga0059261_1277 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) (Sphingomonas koreensis DSMZ 15582)
MAGFELQRIALSTGVELDVATAGDPAAPAIILLHGFPESHRTWRHQIPELAKTHFVIAPD
QRGFARSSKPEGAENYAPDKTVGDLIALADHFGKDRFVLVGHDWGGAIAWMAALQHPNRV
ERLIIVNAPHPFVFQKSLFDDMEQRAASQYIRLFRNPGLEAQLEAMGLGTFFDTTFARHA
NPALLAPERDAYLDEWSQPGAMTAMLNWYRASAIVVPGMDETPERPAFLDGPFPSLQMPV
LVIWGMGDTALLPVQLEGLDQLVPDLKIVEVDAGHFVPWENPAAVNAAIREWLP