Protein Info for Ga0059261_1233 in Sphingomonas koreensis DSMZ 15582

Annotation: Transposase and inactivated derivatives

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF13276: HTH_21" amino acids 44 to 98 (55 residues), 44.4 bits, see alignment E=3.2e-15 PF00665: rve" amino acids 115 to 210 (96 residues), 70.5 bits, see alignment E=2.6e-23 PF13683: rve_3" amino acids 199 to 264 (66 residues), 108.3 bits, see alignment E=2.4e-35 PF13333: rve_2" amino acids 217 to 267 (51 residues), 29.8 bits, see alignment 1.1e-10

Best Hits

KEGG orthology group: None (inferred from 93% identity to eli:ELI_09105)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WAK9 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Ga0059261_1233 Transposase and inactivated derivatives (Sphingomonas koreensis DSMZ 15582)
LTPAAKREAVAHLQDCHGMSERRACHVIGADRKSVRYRSQRADDAELREKLRELANQRRR
FGYRRLHILLRREGVMINRKKTQRLYREEGLAVRRRRSRKRAVGTRAPAPVLALPNQRWS
LDFVHDQMASGRRFRVLNVVDDVTRECLAAVPDTSISGGRVVRELTELIAQRGKPGMIVS
DNGTELTSNAVLAWCGEIGVERHYIAPGKPVQNGYVESFNGRMRDELLNETLFLSLAHAR
VEIAAWVEDYNRERPHSSLGYATPAAFAAELDKQWTDSLRPPGSATQPIASTALKRKTTA
RL