Protein Info for Ga0059261_1053 in Sphingomonas koreensis DSMZ 15582

Annotation: amino acid/polyamine/organocation transporter, APC superfamily (TC 2.A.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 58 to 81 (24 residues), see Phobius details amino acids 89 to 132 (44 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 252 to 275 (24 residues), see Phobius details amino acids 330 to 352 (23 residues), see Phobius details amino acids 381 to 400 (20 residues), see Phobius details amino acids 406 to 426 (21 residues), see Phobius details amino acids 438 to 457 (20 residues), see Phobius details amino acids 464 to 481 (18 residues), see Phobius details PF13520: AA_permease_2" amino acids 25 to 459 (435 residues), 168.4 bits, see alignment E=2.7e-53 PF00324: AA_permease" amino acids 30 to 454 (425 residues), 134.5 bits, see alignment E=4.7e-43

Best Hits

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 81% identity to pzu:PHZ_c1901)

Predicted SEED Role

"Amino acid permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J9V7 at UniProt or InterPro

Protein Sequence (512 amino acids)

>Ga0059261_1053 amino acid/polyamine/organocation transporter, APC superfamily (TC 2.A.3) (Sphingomonas koreensis DSMZ 15582)
MIFGRVKPLDAILATAEKKSLHRSLGAFQLTMLGIGAVIGTGIFVLTAEAAQKAGPGMML
SFVIAGVVCAVAALCYAEMAAMVPVSGSAYTYSYAVMGELIAWMVGWALILEYAVAAGAV
SVGWSGYVVGLIENAFALDIPDALVRGPYDGGIINLPAMLIAGLVTWLLVIGTKESAFVN
SVLVLVKVSALSLFIILAIPVMNMQNFEPFSPLGFAGVSAAAASIFFAYVGFDAVSTAAE
ETKNPQRNMPIGLIGSLAICTIFYLLVAAGVIGSVGAQPILGPDGAALPPGSTELTKACV
ETAAATGKEAVVCSKEALAWTLREIGWPQIGNLIGLAAGLALPSVILMMMFGQTRIFFVM
SRDGLLPAVFSKVHPKFHTPHVITILTGVFVALFAAFFPVGKLADISNSGTLFAFAAVSI
AVLVLRRTDPDRKRPFRTPLIIITAPIAILGCAYLFYSLGHDTKMMFVGWAALGLLVYFG
YSRRKSHVGRGIVETPEHEAYQELDPPVPGTH