Protein Info for Ga0059261_1052 in Sphingomonas koreensis DSMZ 15582

Annotation: Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 PF11969: DcpS_C" amino acids 13 to 117 (105 residues), 48.4 bits, see alignment E=1.3e-16 PF01230: HIT" amino acids 20 to 117 (98 residues), 88.9 bits, see alignment E=2.8e-29

Best Hits

Swiss-Prot: 70% identical to YHIT_AZOBR: Uncharacterized 13.2 kDa HIT-like protein in hisE 3'region from Azospirillum brasilense

KEGG orthology group: None (inferred from 78% identity to sal:Sala_2381)

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)" (EC 3.6.1.17)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J9P2 at UniProt or InterPro

Protein Sequence (125 amino acids)

>Ga0059261_1052 Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases (Sphingomonas koreensis DSMZ 15582)
MPIDATQPYDDQNIFAKILRGEIPSKRVYEDAYAIAFHDINPLAPTHLLVIPTGAYVSWD
DFSARASDAEIAGFVRAVGIVARQAGAVEPGYRLLANVGANGGQEVPHLHIHIFAGKTLG
PMLTR