Protein Info for Ga0059261_1025 in Sphingomonas koreensis DSMZ 15582

Annotation: outer membrane assembly lipoprotein YfiO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 7 to 245 (239 residues), 286.9 bits, see alignment E=6.2e-90 PF13525: YfiO" amino acids 41 to 232 (192 residues), 176.4 bits, see alignment E=9.9e-56 PF13512: TPR_18" amino acids 41 to 162 (122 residues), 51.3 bits, see alignment E=2.2e-17 PF13174: TPR_6" amino acids 114 to 154 (41 residues), 21 bits, see alignment 6.1e-08 amino acids 210 to 241 (32 residues), 19.3 bits, see alignment 2.2e-07

Best Hits

Swiss-Prot: 50% identical to BAMD_CAUVC: Outer membrane protein assembly factor BamD (bamD) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K05807, putative lipoprotein (inferred from 74% identity to sal:Sala_0545)

Predicted SEED Role

"competence lipoprotein ComL, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WA19 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Ga0059261_1025 outer membrane assembly lipoprotein YfiO (Sphingomonas koreensis DSMZ 15582)
MRMLPIRTTALVLVAALALAGCARGGGTRADLPYVARDVGTLYTAAKDRLDRGQYKLAAA
LFDEVERQHPYSVWARRAQLMGAFAYYLDRNYTQAIQSSQRFLAVHPGNRDAPYAYYLIA
LSYYEQISDVTRDQKITQQALDALGELNRRYPNTRYAADARLKVDLVRDHLAGKEMEVGR
YYQVRGQWLAAIIRFRTVVDTYQTTTHTPEALMRLTESYLALGVKEEAKKAAAVLGANYP
GTQWYARAYELIGKHGEAVAVPASAAATAPKLDDVPKPKPVDDETN