Protein Info for Ga0059261_0994 in Sphingomonas koreensis DSMZ 15582

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF13439: Glyco_transf_4" amino acids 14 to 165 (152 residues), 72.1 bits, see alignment E=1.2e-23 PF13692: Glyco_trans_1_4" amino acids 183 to 303 (121 residues), 66.6 bits, see alignment E=6e-22 PF00534: Glycos_transf_1" amino acids 183 to 288 (106 residues), 56.5 bits, see alignment E=5.2e-19 PF20706: GT4-conflict" amino acids 238 to 291 (54 residues), 28.8 bits, see alignment 1.3e-10

Best Hits

KEGG orthology group: None (inferred from 69% identity to sch:Sphch_0226)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JG71 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Ga0059261_0994 Glycosyltransferase (Sphingomonas koreensis DSMZ 15582)
MRIAIVTDAWEPQVNGVVRTLQSVRRVLEAQGHKVLVISPDLFYSVPCPTYPEIRLAMVR
SRTIGDLLDEFSPHAVHLATEGPVCVAARRWCLKHDFPFTTAYHTQFPDYVEARSGVPAE
WVWRYIRWFHAPAQSILASTPSIRQALVDHGLTQVRHWGRGVDLANFRPGLEPHPAMAGL
EGPVQLYVGRVAVEKNLEAFLASKHPGTKVVVGDGPARTALAAKYPQARFLGSMFGGELA
SAYAAADVFVFPSKTDTFGLVMIEALACGTPVAAYPVTGPVDILTPETGAMDEDLDAAIA
AALTKDRAACAEYGRGFTWEASAHQFLMALVPIVEEARAA