Protein Info for Ga0059261_0970 in Sphingomonas koreensis DSMZ 15582

Annotation: ATP synthase, F1 beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 TIGR01039: ATP synthase F1, beta subunit" amino acids 36 to 505 (470 residues), 822.6 bits, see alignment E=4.7e-252 PF02874: ATP-synt_ab_N" amino acids 39 to 105 (67 residues), 69 bits, see alignment E=4.2e-23 PF00006: ATP-synt_ab" amino acids 162 to 387 (226 residues), 229.6 bits, see alignment E=3.5e-72

Best Hits

Swiss-Prot: 85% identical to ATPB_SPHAL: ATP synthase subunit beta (atpD) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K02112, F-type H+-transporting ATPase subunit beta [EC: 3.6.3.14] (inferred from 93% identity to sch:Sphch_0066)

MetaCyc: 76% identical to ATP synthase subunit beta, mitochondrial (Homo sapiens)

Predicted SEED Role

"ATP synthase beta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W9W3 at UniProt or InterPro

Protein Sequence (509 amino acids)

>Ga0059261_0970 ATP synthase, F1 beta subunit (Sphingomonas koreensis DSMZ 15582)
MATAAPTAEKPARKPRAAKPKADATVASAPVAAAGTGRIAQVIGAVVDVAFDGELPAILS
ALETDNNGNRLVLEVAQHLGENTVRTIAMDSTEGLTRGQAVTATGAQIQVPVGPATLGRI
LNVVGEPIDERGPVATDLRAPIHAEAPLFVDQSTESAILVTGIKVIDLLAPYAKGGKIGL
FGGAGVGKTVLIQELINNIAKGHGGTSVFAGVGERTREGNDLYHEFLDAGVIAKDADGNA
ISEGSKVALVYGQMNEPPGARARVALSGLTIAEYFRDVEGQDVLFFVDNIFRFTQAGAEV
SALLGRIPSAVGYQPTLSTDMGALQERITSTNKGSITSVQAVYVPADDLTDPAPATSFAH
LDATTVLNRAISELGIYPAVDPLDSTSRVLEPRVVGQDHYDTARAVQSILQKYKSLQDII
AILGMDELSEEDKLTVARARKIQRFLSQPFHVAEVFTGIPGEFVQIEDTIKSFKAVVEGE
YDHLPEAAFYMVGGIDGVIAKAKKLAAEA