Protein Info for Ga0059261_0957 in Sphingomonas koreensis DSMZ 15582

Annotation: Protein of unknown function (DUF2798)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 85 signal peptide" amino acids 12 to 19 (8 residues), see Phobius details transmembrane" amino acids 20 to 35 (16 residues), see Phobius details amino acids 49 to 72 (24 residues), see Phobius details PF11391: DUF2798" amino acids 21 to 77 (57 residues), 72.9 bits, see alignment E=9.2e-25

Best Hits

KEGG orthology group: None (inferred from 65% identity to xau:Xaut_1237)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WA01 at UniProt or InterPro

Protein Sequence (85 amino acids)

>Ga0059261_0957 Protein of unknown function (DUF2798) (Sphingomonas koreensis DSMZ 15582)
MPSKFRPRRLPARHAGLVSAFILSIMMTFVVSAIATARSLGFSEAFPRAWMGAWALSWVI
AFPVLLMVLPVVRRIVGAIVERPSA